| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries) Uniprot P20248 175-432 |
| Domain d2wxvd1: 2wxv D:176-309 [198591] Other proteins in same PDB: d2wxva1, d2wxva2, d2wxvc1, d2wxvc2 automated match to d1vywb1 complexed with so4, wxv |
PDB Entry: 2wxv (more details), 2.6 Å
SCOPe Domain Sequences for d2wxvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wxvd1 a.74.1.1 (D:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap
Timeline for d2wxvd1: