Lineage for d1mcph1 (1mcp H:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739974Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2740039Domain d1mcph1: 1mcp H:1-121 [19859]
    Other proteins in same PDB: d1mcph2, d1mcpl1, d1mcpl2
    part of Fab MCPC603
    complexed with so4

Details for d1mcph1

PDB Entry: 1mcp (more details), 2.7 Å

PDB Description: phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms
PDB Compounds: (H:) iga-kappa mcpc603 fab (heavy chain)

SCOPe Domain Sequences for d1mcph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcph1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqpggslrlscatsgftfsdfymewvrqppgkrlewiaasrnkgnkytt
eysasvkgrfivsrdtsqsilylqmnalraedtaiyycarnyygstwyfdvwgagttvtv
s

SCOPe Domain Coordinates for d1mcph1:

Click to download the PDB-style file with coordinates for d1mcph1.
(The format of our PDB-style files is described here.)

Timeline for d1mcph1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcph2