Class a: All alpha proteins [46456] (289 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) |
Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins) |
Protein Succinate dehydogenase [81708] (2 species) |
Species Escherichia coli [TaxId:562] [81709] (6 PDB entries) |
Domain d2wu5i3: 2wu5 I:451-588 [198584] Other proteins in same PDB: d2wu5a1, d2wu5a2, d2wu5b1, d2wu5b2, d2wu5c_, d2wu5e1, d2wu5e2, d2wu5f1, d2wu5f2, d2wu5g_, d2wu5i1, d2wu5i2, d2wu5j1, d2wu5j2, d2wu5k_ automated match to d1neka1 complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wu5 (more details), 2.8 Å
SCOPe Domain Sequences for d2wu5i3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wu5i3 a.7.3.1 (I:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]} rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs vnmepklrpafppkirty
Timeline for d2wu5i3: