Lineage for d2wu5i3 (2wu5 I:451-588)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261318Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1261395Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 1261396Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 1261433Protein Succinate dehydogenase [81708] (1 species)
  7. 1261434Species Escherichia coli [TaxId:562] [81709] (6 PDB entries)
  8. 1261446Domain d2wu5i3: 2wu5 I:451-588 [198584]
    Other proteins in same PDB: d2wu5a1, d2wu5a2, d2wu5b1, d2wu5b2, d2wu5c_, d2wu5e1, d2wu5e2, d2wu5f1, d2wu5f2, d2wu5g_, d2wu5i1, d2wu5i2, d2wu5j1, d2wu5j2, d2wu5k_
    automated match to d1neka1
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu5i3

PDB Entry: 2wu5 (more details), 2.8 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant
PDB Compounds: (I:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wu5i3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wu5i3 a.7.3.1 (I:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr
vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs
vnmepklrpafppkirty

SCOPe Domain Coordinates for d2wu5i3:

Click to download the PDB-style file with coordinates for d2wu5i3.
(The format of our PDB-style files is described here.)

Timeline for d2wu5i3: