![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [82587] (5 PDB entries) |
![]() | Domain d2wu5f1: 2wu5 F:1-106 [198580] Other proteins in same PDB: d2wu5a1, d2wu5a2, d2wu5a3, d2wu5b2, d2wu5c_, d2wu5e1, d2wu5e2, d2wu5e3, d2wu5f2, d2wu5g_, d2wu5i1, d2wu5i2, d2wu5i3, d2wu5j2, d2wu5k_ automated match to d1nekb2 complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wu5 (more details), 2.8 Å
SCOPe Domain Sequences for d2wu5f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wu5f1 d.15.4.2 (F:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd
Timeline for d2wu5f1: