Lineage for d2wu5a2 (2wu5 A:236-355)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442462Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 1442463Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 1442464Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 1442533Protein Succinate dehydogenase [82818] (1 species)
  7. 1442534Species Escherichia coli [TaxId:562] [82819] (6 PDB entries)
  8. 1442544Domain d2wu5a2: 2wu5 A:236-355 [198573]
    Other proteins in same PDB: d2wu5a1, d2wu5a3, d2wu5b1, d2wu5b2, d2wu5c_, d2wu5e1, d2wu5e3, d2wu5f1, d2wu5f2, d2wu5g_, d2wu5i1, d2wu5i3, d2wu5j1, d2wu5j2, d2wu5k_
    automated match to d1neka3
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu5a2

PDB Entry: 2wu5 (more details), 2.8 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant
PDB Compounds: (A:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wu5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wu5a2 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
memwqfhptgiagagvlvtegcrgeggyllnkhgerfmeryapnakdlagrdvvarsimi
eiregrgcdgpwgphaklkldhlgkevlesrlpgilelsrtfahvdpvkepipviptchy

SCOPe Domain Coordinates for d2wu5a2:

Click to download the PDB-style file with coordinates for d2wu5a2.
(The format of our PDB-style files is described here.)

Timeline for d2wu5a2: