SCOP 1.65: Domain d2imm__: 2imm -

Lineage for d2imm__ (2imm -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (22 PDB entries)

8. Domain d2imm__: 2imm - [19857]
   VL domain only of MCPC603
   complexed with ace, so4

Details for d2imm__

PDB Entry: 2imm, 2 Å

PDB Description: Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant

SCOP Domain Sequences for d2imm__:

Sequence; same for both SEQRES and ATOM records:

>d2imm__ b.1.1.1 (-) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr

Timeline for d2imm__:

• d2imm__ first appeared (with stable ids) in SCOP 1.55
  
• d2imm__ appears in SCOP 1.63
  
• d2imm__ appears in SCOP 1.67
  
• d2imm__ appears in the current release, SCOPe 2.08, called d2imma_