![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [82587] (6 PDB entries) |
![]() | Domain d2wu2j1: 2wu2 J:1-106 [198569] Other proteins in same PDB: d2wu2a1, d2wu2a2, d2wu2a3, d2wu2b2, d2wu2c_, d2wu2d_, d2wu2e1, d2wu2e2, d2wu2e3, d2wu2f2, d2wu2g_, d2wu2h_, d2wu2i1, d2wu2i2, d2wu2i3, d2wu2j2, d2wu2k_, d2wu2l_ automated match to d1nekb2 complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wu2 (more details), 2.5 Å
SCOPe Domain Sequences for d2wu2j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wu2j1 d.15.4.2 (J:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd
Timeline for d2wu2j1: