Class a: All alpha proteins [46456] (286 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) |
Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins) |
Protein Succinate dehydogenase [81708] (2 species) |
Species Escherichia coli [TaxId:562] [81709] (6 PDB entries) |
Domain d2wu2i3: 2wu2 I:451-588 [198568] Other proteins in same PDB: d2wu2a1, d2wu2a2, d2wu2b1, d2wu2b2, d2wu2c_, d2wu2d_, d2wu2e1, d2wu2e2, d2wu2f1, d2wu2f2, d2wu2g_, d2wu2h_, d2wu2i1, d2wu2i2, d2wu2j1, d2wu2j2, d2wu2k_, d2wu2l_ automated match to d1neka1 complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wu2 (more details), 2.5 Å
SCOPe Domain Sequences for d2wu2i3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wu2i3 a.7.3.1 (I:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]} rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs vnmepklrpafppkirty
Timeline for d2wu2i3: