Lineage for d2wu2h_ (2wu2 H:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629948Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2630045Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2630065Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2630134Protein Succinate dehydrogenase subunit SdhD [82872] (1 species)
    membrane anchor protein
  7. 2630135Species Escherichia coli [TaxId:562] [82873] (7 PDB entries)
  8. 2630140Domain d2wu2h_: 2wu2 H: [198565]
    Other proteins in same PDB: d2wu2a1, d2wu2a2, d2wu2a3, d2wu2b1, d2wu2b2, d2wu2c_, d2wu2e1, d2wu2e2, d2wu2e3, d2wu2f1, d2wu2f2, d2wu2g_, d2wu2i1, d2wu2i2, d2wu2i3, d2wu2j1, d2wu2j2, d2wu2k_
    automated match to d1nekd_
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu2h_

PDB Entry: 2wu2 (more details), 2.5 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant
PDB Compounds: (H:) succinate dehydrogenase hydrophobic membrane anchor protein subunit

SCOPe Domain Sequences for d2wu2h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wu2h_ f.21.2.2 (H:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]}
ngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftllalfsili
hawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv

SCOPe Domain Coordinates for d2wu2h_:

Click to download the PDB-style file with coordinates for d2wu2h_.
(The format of our PDB-style files is described here.)

Timeline for d2wu2h_: