Lineage for d2wu2f2 (2wu2 F:107-238)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1475895Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1475896Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 1475925Protein Succinate dehydogenase [81669] (3 species)
  7. 1475936Species Escherichia coli [TaxId:562] [81670] (5 PDB entries)
  8. 1475941Domain d2wu2f2: 2wu2 F:107-238 [198564]
    Other proteins in same PDB: d2wu2a1, d2wu2a2, d2wu2a3, d2wu2b1, d2wu2c_, d2wu2d_, d2wu2e1, d2wu2e2, d2wu2e3, d2wu2f1, d2wu2g_, d2wu2h_, d2wu2i1, d2wu2i2, d2wu2i3, d2wu2j1, d2wu2k_, d2wu2l_
    automated match to d1nekb1
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu2f2

PDB Entry: 2wu2 (more details), 2.5 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant
PDB Compounds: (F:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d2wu2f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wu2f2 a.1.2.1 (F:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

SCOPe Domain Coordinates for d2wu2f2:

Click to download the PDB-style file with coordinates for d2wu2f2.
(The format of our PDB-style files is described here.)

Timeline for d2wu2f2: