![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
![]() | Protein Succinate dehydogenase [81669] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [81670] (5 PDB entries) |
![]() | Domain d2wu2f2: 2wu2 F:107-238 [198564] Other proteins in same PDB: d2wu2a1, d2wu2a2, d2wu2a3, d2wu2b1, d2wu2c_, d2wu2d_, d2wu2e1, d2wu2e2, d2wu2e3, d2wu2f1, d2wu2g_, d2wu2h_, d2wu2i1, d2wu2i2, d2wu2i3, d2wu2j1, d2wu2k_, d2wu2l_ automated match to d1nekb1 complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wu2 (more details), 2.5 Å
SCOPe Domain Sequences for d2wu2f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wu2f2 a.1.2.1 (F:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai ghiksmllqrna
Timeline for d2wu2f2: