SCOPe 2.08: Domain d2wu2f2: 2wu2 F:107-238

Lineage for d2wu2f2 (2wu2 F:107-238)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Succinate dehydogenase [81669] (3 species)

7. Species Escherichia coli [TaxId:562] [81670] (6 PDB entries)

8. Domain d2wu2f2: 2wu2 F:107-238 [198564]
   Other proteins in same PDB: d2wu2a1, d2wu2a2, d2wu2a3, d2wu2b1, d2wu2c_, d2wu2d_, d2wu2e1, d2wu2e2, d2wu2e3, d2wu2f1, d2wu2g_, d2wu2h_, d2wu2i1, d2wu2i2, d2wu2i3, d2wu2j1, d2wu2k_, d2wu2l_
   automated match to d1nekb1
   complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu2f2

PDB Entry: 2wu2, 2.5 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant

PDB Compounds: (F:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d2wu2f2:

Sequence; same for both SEQRES and ATOM records:

>d2wu2f2 a.1.2.1 (F:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

Timeline for d2wu2f2:

• d2wu2f2 first appeared in SCOPe 2.03
  
• d2wu2f2 appears in SCOPe 2.07