Lineage for d2imna_ (2imn A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353666Species Engineered (including hybrid species) [88533] (63 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2353667Domain d2imna_: 2imn A: [19856]
    VL domain only of humanized antibody MCPC603
    complexed with act, so4; mutant

Details for d2imna_

PDB Entry: 2imn (more details), 1.97 Å

PDB Description: Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant
PDB Compounds: (A:) iga-kappa mcpc603 fv (light chain)

SCOPe Domain Sequences for d2imna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imna_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
divmtqspsslsvsagervtmsckssqsllykdgknflawyqqkpgqppklliygastre
sgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr

SCOPe Domain Coordinates for d2imna_:

Click to download the PDB-style file with coordinates for d2imna_.
(The format of our PDB-style files is described here.)

Timeline for d2imna_: