Lineage for d2imn__ (2imn -)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287739Species Engineered (including hybrid species) [88533] (25 PDB entries)
  8. 287742Domain d2imn__: 2imn - [19856]
    VL domain only of humanized antibody MCPC603
    complexed with ace, so4; mutant

Details for d2imn__

PDB Entry: 2imn (more details), 1.97 Å

PDB Description: Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant

SCOP Domain Sequences for d2imn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imn__ b.1.1.1 (-) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
divmtqspsslsvsagervtmsckssqsllykdgknflawyqqkpgqppklliygastre
sgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr

SCOP Domain Coordinates for d2imn__:

Click to download the PDB-style file with coordinates for d2imn__.
(The format of our PDB-style files is described here.)

Timeline for d2imn__: