Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fab MCPC603 (human), kappa L chain [48770] (4 PDB entries) |
Domain d2imn__: 2imn - [19856] |
PDB Entry: 2imn (more details), 1.97 Å
SCOP Domain Sequences for d2imn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2imn__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Fab MCPC603 (human), kappa L chain} divmtqspsslsvsagervtmsckssqsllykdgknflawyqqkpgqppklliygastre sgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr
Timeline for d2imn__: