| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
| Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
| Protein Succinate dehydrogenase subunit SdhD [82872] (1 species) membrane anchor protein |
| Species Escherichia coli [TaxId:562] [82873] (7 PDB entries) |
| Domain d2wu2d_: 2wu2 D: [198559] Other proteins in same PDB: d2wu2a1, d2wu2a2, d2wu2a3, d2wu2b1, d2wu2b2, d2wu2c_, d2wu2e1, d2wu2e2, d2wu2e3, d2wu2f1, d2wu2f2, d2wu2g_, d2wu2i1, d2wu2i2, d2wu2i3, d2wu2j1, d2wu2j2, d2wu2k_ automated match to d1nekd_ complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wu2 (more details), 2.5 Å
SCOPe Domain Sequences for d2wu2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wu2d_ f.21.2.2 (D:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]}
ngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftllalfsili
hawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv
Timeline for d2wu2d_: