Lineage for d2wu2a3 (2wu2 A:451-588)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696597Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2696598Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2696637Protein Succinate dehydogenase [81708] (3 species)
  7. 2696638Species Escherichia coli [TaxId:562] [81709] (7 PDB entries)
  8. 2696639Domain d2wu2a3: 2wu2 A:451-588 [198556]
    Other proteins in same PDB: d2wu2a1, d2wu2a2, d2wu2b1, d2wu2b2, d2wu2c_, d2wu2d_, d2wu2e1, d2wu2e2, d2wu2f1, d2wu2f2, d2wu2g_, d2wu2h_, d2wu2i1, d2wu2i2, d2wu2j1, d2wu2j2, d2wu2k_, d2wu2l_
    automated match to d1neka1
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu2a3

PDB Entry: 2wu2 (more details), 2.5 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant
PDB Compounds: (A:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wu2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wu2a3 a.7.3.1 (A:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr
vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs
vnmepklrpafppkirty

SCOPe Domain Coordinates for d2wu2a3:

Click to download the PDB-style file with coordinates for d2wu2a3.
(The format of our PDB-style files is described here.)

Timeline for d2wu2a3: