Lineage for d2wu2a2 (2wu2 A:236-355)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001255Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 3001256Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 3001257Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 3001328Protein Succinate dehydogenase [82818] (3 species)
  7. 3001329Species Escherichia coli [TaxId:562] [82819] (6 PDB entries)
  8. 3001330Domain d2wu2a2: 2wu2 A:236-355 [198555]
    Other proteins in same PDB: d2wu2a1, d2wu2a3, d2wu2b1, d2wu2b2, d2wu2c_, d2wu2d_, d2wu2e1, d2wu2e3, d2wu2f1, d2wu2f2, d2wu2g_, d2wu2h_, d2wu2i1, d2wu2i3, d2wu2j1, d2wu2j2, d2wu2k_, d2wu2l_
    automated match to d1neka3
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu2a2

PDB Entry: 2wu2 (more details), 2.5 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant
PDB Compounds: (A:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wu2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wu2a2 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
memwqfhptgiagagvlvtegcrgeggyllnkhgerfmeryapnakdlagrdvvarsimi
eiregrgcdgpwgphaklkldhlgkevlesrlpgilelsrtfahvdpvkepipviptchy

SCOPe Domain Coordinates for d2wu2a2:

Click to download the PDB-style file with coordinates for d2wu2a2.
(The format of our PDB-style files is described here.)

Timeline for d2wu2a2: