Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [196063] (3 PDB entries) |
Domain d2wtlb1: 2wtl B:2-159 [198547] Other proteins in same PDB: d2wtla2, d2wtlb2, d2wtlc2, d2wtld2, d2wtle2, d2wtlf2 automated match to d2wtlf_ complexed with fe, unl, unx |
PDB Entry: 2wtl (more details), 2.59 Å
SCOPe Domain Sequences for d2wtlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wtlb1 a.25.1.0 (B:2-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle kivadeeehidyletqlelmdklgeelysaqcvsrppt
Timeline for d2wtlb1: