SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2wtlb1 (2wtl B:2-159)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990537Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1990538Protein automated matches [190036] (34 species)
    not a true protein
  7. 1990791Species Mycobacterium tuberculosis [TaxId:83332] [196063] (2 PDB entries)
  8. 1990799Domain d2wtlb1: 2wtl B:2-159 [198547]
    Other proteins in same PDB: d2wtla2, d2wtlb2, d2wtlc2, d2wtld2, d2wtle2, d2wtlf2
    automated match to d2wtlf_
    complexed with fe, unl, unx

Details for d2wtlb1

PDB Entry: 2wtl (more details), 2.59 Å

PDB Description: crystal structure of bfra from m. tuberculosis
PDB Compounds: (B:) bacterioferritin

SCOPe Domain Sequences for d2wtlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wtlb1 a.25.1.0 (B:2-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
kivadeeehidyletqlelmdklgeelysaqcvsrppt

SCOPe Domain Coordinates for d2wtlb1:

Click to download the PDB-style file with coordinates for d2wtlb1.
(The format of our PDB-style files is described here.)

Timeline for d2wtlb1: