Lineage for d2wtla_ (2wtl A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1265913Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1265914Protein automated matches [190036] (19 species)
    not a true protein
  7. 1266038Species Mycobacterium tuberculosis [TaxId:83332] [196063] (2 PDB entries)
  8. 1266045Domain d2wtla_: 2wtl A: [198546]
    automated match to d2wtlf_
    complexed with fe, unl, unx

Details for d2wtla_

PDB Entry: 2wtl (more details), 2.59 Å

PDB Description: crystal structure of bfra from m. tuberculosis
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d2wtla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wtla_ a.25.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
kivadeeehidyletqlelmdklgeelysaqcvsrpptsaw

SCOPe Domain Coordinates for d2wtla_:

Click to download the PDB-style file with coordinates for d2wtla_.
(The format of our PDB-style files is described here.)

Timeline for d2wtla_: