SCOPe 2.08: Domain d2wtla1: 2wtl A:2-159

Lineage for d2wtla1 (2wtl A:2-159)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (60 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [196063] (3 PDB entries)

8. Domain d2wtla1: 2wtl A:2-159 [198546]
   Other proteins in same PDB: d2wtla2, d2wtlb2, d2wtlc2, d2wtld2, d2wtle2, d2wtlf2
   automated match to d2wtlf_
   complexed with fe, unl, unx

Details for d2wtla1

PDB Entry: 2wtl, 2.59 Å

PDB Description: crystal structure of bfra from m. tuberculosis

PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d2wtla1:

Sequence; same for both SEQRES and ATOM records:

>d2wtla1 a.25.1.0 (A:2-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
kivadeeehidyletqlelmdklgeelysaqcvsrppt

Timeline for d2wtla1:

• d2wtla1 first appeared in SCOPe 2.03, called d2wtla_
  
• d2wtla1 appears in SCOPe 2.07