Lineage for d2wtkf1 (2wtk F:45-310)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries)
  8. 2199964Domain d2wtkf1: 2wtk F:45-310 [198545]
    Other proteins in same PDB: d2wtka_, d2wtkd_
    automated match to d2qkra_
    complexed with anp, so4

Details for d2wtkf1

PDB Entry: 2wtk (more details), 2.65 Å

PDB Description: structure of the heterotrimeric lkb1-stradalpha-mo25alpha complex
PDB Compounds: (F:) serine/threonine-protein kinase 11

SCOPe Domain Sequences for d2wtkf1:

Sequence, based on SEQRES records: (download)

>d2wtkf1 d.144.1.0 (F:45-310) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ligkylmgdllgegsygkvkevldsetlcrravkilkkkklrripngeanvkkeiqllrr
lrhknviqlvdvlyneekqkmymvmeycvcgmqemldsvpekrfpvcqahgyfcqlidgl
eylhsqgivhkdikpgnlllttggtlkisalgvaealhpfaaddtcrtsqgspafqppei
angldtfsgfkvdiwsagvtlynittglypfegdniyklfenigkgsyaipgdcgpplsd
llkgmleyepakrfsirqirqhswfr

Sequence, based on observed residues (ATOM records): (download)

>d2wtkf1 d.144.1.0 (F:45-310) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ligkylmgdllgegsygkvkevldsetlcrravkilkkkklrripngeanvkkeiqllrr
lrhknviqlvdvlynmymvmeycvcgmqemldsvpekrfpvcqahgyfcqlidgleylhs
qgivhkdikpgnlllttggtlkisalgvaealhpfaaddtcrtsqgspafqppeiangld
tfsgfkvdiwsagvtlynittglypfegklfenigkgaipglsdllkgmleyepakrfsi
rqirqhswfr

SCOPe Domain Coordinates for d2wtkf1:

Click to download the PDB-style file with coordinates for d2wtkf1.
(The format of our PDB-style files is described here.)

Timeline for d2wtkf1: