SCOPe 2.05: Domain d2wpbc_: 2wpb C:

Lineage for d2wpbc_ (2wpb C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (20 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189174] (6 PDB entries)

8. Domain d2wpbc_: 2wpb C: [198543]
   automated match to d2wpbd_
   complexed with zzi; mutant

Details for d2wpbc_

PDB Entry: 2wpb, 2.05 Å

PDB Description: crystal structure of the e192n mutant of e. coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4-trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i

PDB Compounds: (C:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d2wpbc_:

Sequence; same for both SEQRES and ATOM records:

>d2wpbc_ c.1.10.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq
vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh
yraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalxqtsgdlyqmeqirreh
pdlvlyngydnifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk
vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqer

Timeline for d2wpbc_:

• d2wpbc_ first appeared in SCOPe 2.03
  
• d2wpbc_ appears in SCOPe 2.04
  
• d2wpbc_ appears in SCOPe 2.06
  
• d2wpbc_ appears in the current release, SCOPe 2.08