SCOP 1.67: Domain d2fgwl1: 2fgw L:1-108

Lineage for d2fgwl1 (2fgw L:1-108)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (27 PDB entries)

8. Domain d2fgwl1: 2fgw L:1-108 [19854]
   Other proteins in same PDB: d2fgwh1, d2fgwh2, d2fgwl2
   part of humanized Fab H52

Details for d2fgwl1

PDB Entry: 2fgw, 3 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

SCOP Domain Sequences for d2fgwl1:

Sequence; same for both SEQRES and ATOM records:

>d2fgwl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlhsgvps
rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgqgtkveikr

Timeline for d2fgwl1:

• d2fgwl1 first appeared (with stable ids) in SCOP 1.55
  
• d2fgwl1 appears in SCOP 1.65
  
• d2fgwl1 appears in SCOP 1.69
  
• d2fgwl1 appears in the current release, SCOPe 2.08