Lineage for d2wp9l_ (2wp9 L:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697409Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1697498Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 1697516Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 1697582Protein Succinate dehydrogenase subunit SdhD [82872] (1 species)
    membrane anchor protein
  7. 1697583Species Escherichia coli [TaxId:562] [82873] (6 PDB entries)
  8. 1697592Domain d2wp9l_: 2wp9 L: [198536]
    Other proteins in same PDB: d2wp9a1, d2wp9a2, d2wp9a3, d2wp9b1, d2wp9b2, d2wp9c_, d2wp9e1, d2wp9e2, d2wp9e3, d2wp9f1, d2wp9f2, d2wp9g_, d2wp9i1, d2wp9i2, d2wp9i3, d2wp9j1, d2wp9j2, d2wp9k_
    automated match to d1nekd_
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wp9l_

PDB Entry: 2wp9 (more details), 2.7 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant
PDB Compounds: (L:) succinate dehydrogenase hydrophobic membrane anchor subunit

SCOPe Domain Sequences for d2wp9l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wp9l_ f.21.2.2 (L:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]}
ngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftllalfsili
hawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv

SCOPe Domain Coordinates for d2wp9l_:

Click to download the PDB-style file with coordinates for d2wp9l_.
(The format of our PDB-style files is described here.)

Timeline for d2wp9l_: