Lineage for d2wp9e2 (2wp9 E:236-355)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234542Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 2234543Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 2234544Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 2234615Protein Succinate dehydogenase [82818] (2 species)
  7. 2234616Species Escherichia coli [TaxId:562] [82819] (6 PDB entries)
  8. 2234624Domain d2wp9e2: 2wp9 E:236-355 [198530]
    Other proteins in same PDB: d2wp9a1, d2wp9a3, d2wp9b1, d2wp9b2, d2wp9c_, d2wp9d_, d2wp9e1, d2wp9e3, d2wp9f1, d2wp9f2, d2wp9g_, d2wp9h_, d2wp9i1, d2wp9i3, d2wp9j1, d2wp9j2, d2wp9k_, d2wp9l_
    automated match to d1neka3
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wp9e2

PDB Entry: 2wp9 (more details), 2.7 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant
PDB Compounds: (E:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wp9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wp9e2 d.168.1.1 (E:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
memwqfhptgiagagvlvtegcrgeggyllnkhgerfmeryapnakdlagrdvvarsimi
eiregrgcdgpwgphaklkldhlgkevlesrlpgilelsrtfahvdpvkepipviptchy

SCOPe Domain Coordinates for d2wp9e2:

Click to download the PDB-style file with coordinates for d2wp9e2.
(The format of our PDB-style files is described here.)

Timeline for d2wp9e2: