Lineage for d1fgvh_ (1fgv H:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158194Species Fab H52 (synthetic, humanised version), kappa L chain [48769] (2 PDB entries)
  8. 158195Domain d1fgvh_: 1fgv H: [19853]

Details for d1fgvh_

PDB Entry: 1fgv (more details), 1.9 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

SCOP Domain Sequences for d1fgvh_:

Sequence, based on SEQRES records: (download)

>d1fgvh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain}
evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
adsvkgrftisvdkskntlylqmnslraedtavyycarwrglnygfdvryfdvwgqgtlv
tvss

Sequence, based on observed residues (ATOM records): (download)

>d1fgvh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain}
evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
adsvkgrftisvdkskntlylqmnslraedtavyycarwrgldvryfdvwgqgtlvtvss

SCOP Domain Coordinates for d1fgvh_:

Click to download the PDB-style file with coordinates for d1fgvh_.
(The format of our PDB-style files is described here.)

Timeline for d1fgvh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fgvl_