Lineage for d1fgvh_ (1fgv H:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Fab H52 (synthetic, humanised version), kappa L chain [48769] (2 PDB entries) 
Domain d1fgvh_: 1fgv H: [19853]
Details for d1fgvh_
PDB Entry: 1fgv (more details), 1.9 Å
PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65
SCOP Domain Sequences for d1fgvh_:
Sequence, based on SEQRES records: (download)
>d1fgvh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain}
evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
adsvkgrftisvdkskntlylqmnslraedtavyycarwrglnygfdvryfdvwgqgtlv
tvss
Sequence, based on observed residues (ATOM records): (download)
>d1fgvh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain}
evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
adsvkgrftisvdkskntlylqmnslraedtavyycarwrgldvryfdvwgqgtlvtvss
SCOP Domain Coordinates for d1fgvh_:
Click to download the PDB-style file with coordinates for d1fgvh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fgvh_:
- d1fgvh_ appears in SCOP 1.57
- d1fgvh_ appears in the current release, SCOPe 2.08
View in 3D
