SCOPe 2.08: Domain d1fgvh_: 1fgv H:

Lineage for d1fgvh_ (1fgv H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (67 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d1fgvh_: 1fgv H: [19853]
   Other proteins in same PDB: d1fgvl_
   part of humanized Fv H52

Details for d1fgvh_

PDB Entry: 1fgv, 1.9 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

PDB Compounds: (H:) h52 fv (heavy chain)

SCOPe Domain Sequences for d1fgvh_:

Sequence, based on SEQRES records:

>d1fgvh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
adsvkgrftisvdkskntlylqmnslraedtavyycarwrglnygfdvryfdvwgqgtlv
tvss

Sequence, based on observed residues (ATOM records):

>d1fgvh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
adsvkgrftisvdkskntlylqmnslraedtavyycarwrgldvryfdvwgqgtlvtvss

Timeline for d1fgvh_:

• d1fgvh_ first appeared (with stable ids) in SCOP 1.55
  
• d1fgvh_ appears in SCOPe 2.07