Lineage for d2wp9e1 (2wp9 E:1-235,E:356-450)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1351449Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1351450Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1351868Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 1351937Protein Succinate dehydogenase [82311] (1 species)
  7. 1351938Species Escherichia coli [TaxId:562] [82312] (6 PDB entries)
  8. 1351946Domain d2wp9e1: 2wp9 E:1-235,E:356-450 [198529]
    Other proteins in same PDB: d2wp9a2, d2wp9a3, d2wp9b1, d2wp9b2, d2wp9c_, d2wp9d_, d2wp9e2, d2wp9e3, d2wp9g_, d2wp9h_, d2wp9i2, d2wp9i3, d2wp9k_, d2wp9l_
    automated match to d1neka2
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wp9e1

PDB Entry: 2wp9 (more details), 2.7 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant
PDB Compounds: (E:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wp9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wp9e1 c.3.1.4 (E:1-235,E:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mklpvrefdavvigaggagmraalqisqsgqtcallskvfptrshtvsaqggitvalgnt
hednwewhmydtvkgsdyigdqdaieymcktgpeailelehmglpfsrlddgriyqrpfg
gqsknfggeqaartaaaadrtghallhtlyqqnlknhttifsewyaldlvknqdgavvgc
talcietgevvyfkaratvlatggagriyqsttnahintgdgvgmairagvpvqdXmmgg
iptkvtgqaltvnekgedvvvpglfavgeiacvsvhganrlggnslldlvvfgraaglhl
qesiaeqgalrdasesdveasldrlnrwnnn

SCOPe Domain Coordinates for d2wp9e1:

Click to download the PDB-style file with coordinates for d2wp9e1.
(The format of our PDB-style files is described here.)

Timeline for d2wp9e1: