Lineage for d2wp9a3 (2wp9 A:451-588)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309960Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2309961Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2310000Protein Succinate dehydogenase [81708] (3 species)
  7. 2310001Species Escherichia coli [TaxId:562] [81709] (7 PDB entries)
  8. 2310008Domain d2wp9a3: 2wp9 A:451-588 [198527]
    Other proteins in same PDB: d2wp9a1, d2wp9a2, d2wp9b1, d2wp9b2, d2wp9c_, d2wp9d_, d2wp9e1, d2wp9e2, d2wp9f1, d2wp9f2, d2wp9g_, d2wp9h_, d2wp9i1, d2wp9i2, d2wp9j1, d2wp9j2, d2wp9k_, d2wp9l_
    automated match to d1neka1
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wp9a3

PDB Entry: 2wp9 (more details), 2.7 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant
PDB Compounds: (A:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wp9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wp9a3 a.7.3.1 (A:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr
vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs
vnmepklrpafppkirty

SCOPe Domain Coordinates for d2wp9a3:

Click to download the PDB-style file with coordinates for d2wp9a3.
(The format of our PDB-style files is described here.)

Timeline for d2wp9a3: