| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) ![]() |
| Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins) |
| Protein Succinate dehydogenase [81708] (3 species) |
| Species Escherichia coli [TaxId:562] [81709] (7 PDB entries) |
| Domain d2wp9a3: 2wp9 A:451-588 [198527] Other proteins in same PDB: d2wp9a1, d2wp9a2, d2wp9b1, d2wp9b2, d2wp9c_, d2wp9d_, d2wp9e1, d2wp9e2, d2wp9f1, d2wp9f2, d2wp9g_, d2wp9h_, d2wp9i1, d2wp9i2, d2wp9j1, d2wp9j2, d2wp9k_, d2wp9l_ automated match to d1neka1 complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wp9 (more details), 2.7 Å
SCOPe Domain Sequences for d2wp9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wp9a3 a.7.3.1 (A:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr
vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs
vnmepklrpafppkirty
Timeline for d2wp9a3: