SCOPe 2.03: Domain d2woeb_: 2woe B:

Lineage for d2woeb_ (2woe B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
   multihelical; bundle

4. Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families)

5. Family a.209.1.0: automated matches [191592] (1 protein)
   not a true family

6. Protein automated matches [191071] (2 species)
   not a true protein

7. Species Rhodospirillum rubrum [TaxId:1085] [196535] (3 PDB entries)

8. Domain d2woeb_: 2woe B: [198522]
   automated match to d2woec_
   complexed with ar6, gol, mn, tla

Details for d2woeb_

PDB Entry: 2woe, 1.9 Å

PDB Description: crystal structure of the d97n variant of dinitrogenase reductase-activating glycohydrolase (drag) from rhodospirillum rubrum in complex with adp-ribose

PDB Compounds: (B:) ADP-ribosyl-[dinitrogen reductase] glycohydrolase

SCOPe Domain Sequences for d2woeb_:

Sequence; same for both SEQRES and ATOM records:

>d2woeb_ a.209.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
emslalgrslaakgtldvadiceefalwlksrpvnvgntcrrgirrymhegtttapyseg
dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl

Timeline for d2woeb_:

• d2woeb_ is new in SCOPe 2.03-stable
  
• d2woeb_ appears in SCOPe 2.04
  
• d2woeb_ appears in the current release, SCOPe 2.08