Lineage for d2woeb_ (2woe B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736587Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
    multihelical; bundle
  4. 2736588Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families) (S)
  5. 2736593Family a.209.1.0: automated matches [191592] (1 protein)
    not a true family
  6. 2736594Protein automated matches [191071] (2 species)
    not a true protein
  7. 2736600Species Rhodospirillum rubrum [TaxId:1085] [196535] (3 PDB entries)
  8. 2736602Domain d2woeb_: 2woe B: [198522]
    automated match to d2woec_
    complexed with ar6, gol, mn, tla

Details for d2woeb_

PDB Entry: 2woe (more details), 1.9 Å

PDB Description: crystal structure of the d97n variant of dinitrogenase reductase-activating glycohydrolase (drag) from rhodospirillum rubrum in complex with adp-ribose
PDB Compounds: (B:) ADP-ribosyl-[dinitrogen reductase] glycohydrolase

SCOPe Domain Sequences for d2woeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2woeb_ a.209.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
emslalgrslaakgtldvadiceefalwlksrpvnvgntcrrgirrymhegtttapyseg
dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl

SCOPe Domain Coordinates for d2woeb_:

Click to download the PDB-style file with coordinates for d2woeb_.
(The format of our PDB-style files is described here.)

Timeline for d2woeb_: