SCOP 1.57: Domain d1fgvl_: 1fgv L:

Lineage for d1fgvl_ (1fgv L:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab H52 (synthetic, humanised version), kappa L chain [48769] (2 PDB entries)

8. Domain d1fgvl_: 1fgv L: [19852]

Details for d1fgvl_

PDB Entry: 1fgv, 1.9 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

SCOP Domain Sequences for d1fgvl_:

Sequence; same for both SEQRES and ATOM records:

>d1fgvl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain}
diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlesgvps
rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgagtkveik

Timeline for d1fgvl_:

• d1fgvl_ first appeared (with stable ids) in SCOP 1.55
  
• d1fgvl_ appears in SCOP 1.59
  
• d1fgvl_ appears in the current release, SCOPe 2.08