![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein automated matches [190095] (28 species) not a true protein |
![]() | Species Escherichia coli [TaxId:469008] [189446] (6 PDB entries) |
![]() | Domain d2wnza1: 2wnz A:2-297 [198517] Other proteins in same PDB: d2wnza2, d2wnzd2 automated match to d2wnzd_ complexed with 2op, etx, lac; mutant |
PDB Entry: 2wnz (more details), 1.85 Å
SCOPe Domain Sequences for d2wnza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnza1 c.1.10.1 (A:2-297) automated matches {Escherichia coli [TaxId: 469008]} atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh yraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalxqtsgdlyqmeqirreh pdlvlyngydnifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqerg
Timeline for d2wnza1:
![]() Domains from other chains: (mouse over for more information) d2wnzb_, d2wnzc_, d2wnzd1, d2wnzd2 |