Lineage for d2wjmh2 (2wjm H:37-258)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2052955Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2052956Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2052957Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2052958Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2053051Species Rhodopseudomonas viridis [TaxId:1079] [50349] (19 PDB entries)
  8. 2053055Domain d2wjmh2: 2wjm H:37-258 [198510]
    Other proteins in same PDB: d2wjmc_, d2wjmh1, d2wjml_, d2wjmm_
    automated match to d6prch1
    complexed with bcb, bpb, dga, fe2, hem, mpg, mq7, ns5, po4

Details for d2wjmh2

PDB Entry: 2wjm (more details), 1.95 Å

PDB Description: lipidic sponge phase crystal structure of the photosynthetic reaction centre from blastochloris viridis (low dose)
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2wjmh2:

Sequence, based on SEQRES records: (download)

>d2wjmh2 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

Sequence, based on observed residues (ATOM records): (download)

>d2wjmh2 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveelpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvda
vgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdl
wvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprlqsrdqit
lreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d2wjmh2:

Click to download the PDB-style file with coordinates for d2wjmh2.
(The format of our PDB-style files is described here.)

Timeline for d2wjmh2: