SCOP 1.63: Domain d2fbjh1: 2fbj H:1-118

Lineage for d2fbjh1 (2fbj H:1-118)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab J539 (mouse), kappa L chain [48768] (1 PDB entry)

8. Domain d2fbjh1: 2fbj H:1-118 [19851]
   Other proteins in same PDB: d2fbjh2, d2fbjl2
   complexed with fuc, nag, zn

Details for d2fbjh1

PDB Entry: 2fbj, 1.95 Å

PDB Description: refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution

SCOP Domain Sequences for d2fbjh1:

Sequence; same for both SEQRES and ATOM records:

>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Fab J539 (mouse), kappa L chain}
evkllesggglvqpggslklscaasgfdfskywmswvrqapgkglewigeihpdsgtiny
tpslkdkfiisrdnaknslylqmskvrsedtalyycarlhyygynaywgqgtlvtvsa

Timeline for d2fbjh1:

• d2fbjh1 first appeared (with stable ids) in SCOP 1.55
  
• d2fbjh1 appears in SCOP 1.61
  
• d2fbjh1 appears in SCOP 1.65
  
• d2fbjh1 appears in the current release, SCOPe 2.08