| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Fab J539 (mouse), kappa L chain [48768] (1 PDB entry) |
| Domain d2fbjh1: 2fbj H:1-118 [19851] Other proteins in same PDB: d2fbjh2, d2fbjl2 complexed with fuc, nag, zn |
PDB Entry: 2fbj (more details), 1.95 Å
SCOP Domain Sequences for d2fbjh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Fab J539 (mouse), kappa L chain}
evkllesggglvqpggslklscaasgfdfskywmswvrqapgkglewigeihpdsgtiny
tpslkdkfiisrdnaknslylqmskvrsedtalyycarlhyygynaywgqgtlvtvsa
Timeline for d2fbjh1: