SCOPe 2.06: Domain d2wihd2: 2wih D:310-432

Lineage for d2wihd2 (2wih D:310-432)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
   Uniprot P20248 175-432

8. Domain d2wihd2: 2wih D:310-432 [198504]
   Other proteins in same PDB: d2wiha1, d2wiha2, d2wihc1, d2wihc2
   automated match to d1vywb2
   complexed with p48, so4

Details for d2wihd2

PDB Entry: 2wih, 2.5 Å

PDB Description: structure of cdk2-cyclin a with pha-848125

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d2wihd2:

Sequence, based on SEQRES records:

>d2wihd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Sequence, based on observed residues (ATOM records):

>d2wihd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqpanckveslamflgelslidadpylkylpsviagaafhlalytvtgq
swpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppetl
nl

Timeline for d2wihd2:

• d2wihd2 first appeared in SCOPe 2.03
  
• d2wihd2 appears in SCOPe 2.05
  
• d2wihd2 appears in SCOPe 2.07
  
• d2wihd2 appears in the current release, SCOPe 2.08