Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries) Uniprot P20248 175-432 |
Domain d2wihd1: 2wih D:176-309 [198503] Other proteins in same PDB: d2wiha1, d2wiha2, d2wihc1, d2wihc2 automated match to d1vywb1 complexed with p48, so4 |
PDB Entry: 2wih (more details), 2.5 Å
SCOPe Domain Sequences for d2wihd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wihd1 a.74.1.1 (D:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme hlvlkvltfdlaap
Timeline for d2wihd1: