SCOP 1.57: Domain d2fbjl1: 2fbj L:1-109

Lineage for d2fbjl1 (2fbj L:1-109)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab J539 (mouse), kappa L chain [48768] (1 PDB entry)

8. Domain d2fbjl1: 2fbj L:1-109 [19850]
   Other proteins in same PDB: d2fbjh2, d2fbjl2

Details for d2fbjl1

PDB Entry: 2fbj, 1.95 Å

PDB Description: refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution

SCOP Domain Sequences for d2fbjl1:

Sequence; same for both SEQRES and ATOM records:

>d2fbjl1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab J539 (mouse), kappa L chain}
eivltqspaitaaslgqkvtitcsasssvsslhwyqqksgtspkpwiyeisklasgvpar
fsgsgsgtsysltintmeaedaaiyycqqwtyplitfgagtklelkrad

Timeline for d2fbjl1:

• d2fbjl1 first appeared (with stable ids) in SCOP 1.55
  
• d2fbjl1 appears in SCOP 1.59
  
• d2fbjl1 appears in the current release, SCOPe 2.08