Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fab J539 (mouse), kappa L chain [48768] (1 PDB entry) |
Domain d2fbjl1: 2fbj L:1-109 [19850] Other proteins in same PDB: d2fbjh2, d2fbjl2 |
PDB Entry: 2fbj (more details), 1.95 Å
SCOP Domain Sequences for d2fbjl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fbjl1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab J539 (mouse), kappa L chain} eivltqspaitaaslgqkvtitcsasssvsslhwyqqksgtspkpwiyeisklasgvpar fsgsgsgtsysltintmeaedaaiyycqqwtyplitfgagtklelkrad
Timeline for d2fbjl1: