Lineage for d2fbjl1 (2fbj L:1-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741291Species Mouse (Mus musculus), cluster 3.4 [TaxId:10090] [88530] (4 PDB entries)
  8. 2741294Domain d2fbjl1: 2fbj L:1-109 [19850]
    Other proteins in same PDB: d2fbjh1, d2fbjh2, d2fbjl2
    part of Fab J539
    complexed with zn

Details for d2fbjl1

PDB Entry: 2fbj (more details), 1.95 Å

PDB Description: refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution
PDB Compounds: (L:) iga-kappa j539 fab (light chain)

SCOPe Domain Sequences for d2fbjl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbjl1 b.1.1.1 (L:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.4 [TaxId: 10090]}
eivltqspaitaaslgqkvtitcsasssvsslhwyqqksgtspkpwiyeisklasgvpar
fsgsgsgtsysltintmeaedaaiyycqqwtyplitfgagtklelkrad

SCOPe Domain Coordinates for d2fbjl1:

Click to download the PDB-style file with coordinates for d2fbjl1.
(The format of our PDB-style files is described here.)

Timeline for d2fbjl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fbjl2