Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries) Uniprot P20248 175-432 |
Domain d2whbb1: 2whb B:175-309 [198497] Other proteins in same PDB: d2whba_, d2whbc_ automated match to d1jsub1 |
PDB Entry: 2whb (more details), 2.9 Å
SCOPe Domain Sequences for d2whbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2whbb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm ehlvlkvltfdlaap
Timeline for d2whbb1:
View in 3D Domains from other chains: (mouse over for more information) d2whba_, d2whbc_, d2whbd1, d2whbd2 |