SCOP 1.59: Domain d2ig2h1: 2ig2 H:1-119

Lineage for d2ig2h1 (2ig2 H:1-119)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab KOL (human), lambda L chain [48767] (2 PDB entries)

8. Domain d2ig2h1: 2ig2 H:1-119 [19849]
   Other proteins in same PDB: d2ig2h2, d2ig2l2

Details for d2ig2h1

PDB Entry: 2ig2, 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda- typ, subgruppe i (german)

SCOP Domain Sequences for d2ig2h1:

Sequence; same for both SEQRES and ATOM records:

>d2ig2h1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Fab KOL (human), lambda L chain}
evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt
pvtvssa

Timeline for d2ig2h1:

• d2ig2h1 first appeared (with stable ids) in SCOP 1.55
  
• d2ig2h1 appears in SCOP 1.57
  
• d2ig2h1 appears in SCOP 1.61
  
• d2ig2h1 appears in the current release, SCOPe 2.08