SCOPe 2.06: Domain d2wdqj2: 2wdq J:107-238

Lineage for d2wdqj2 (2wdq J:107-238)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Succinate dehydogenase [81669] (3 species)

7. Species Escherichia coli [TaxId:562] [81670] (5 PDB entries)

8. Domain d2wdqj2: 2wdq J:107-238 [198489]
   Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqa3, d2wdqb1, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe2, d2wdqe3, d2wdqf1, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi2, d2wdqi3, d2wdqj1, d2wdqk_, d2wdql_
   automated match to d1nekb1
   complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo

Details for d2wdqj2

PDB Entry: 2wdq, 2.4 Å

PDB Description: e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound

PDB Compounds: (J:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d2wdqj2:

Sequence; same for both SEQRES and ATOM records:

>d2wdqj2 a.1.2.1 (J:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

Timeline for d2wdqj2:

• d2wdqj2 first appeared in SCOPe 2.03
  
• d2wdqj2 appears in SCOPe 2.05
  
• d2wdqj2 appears in SCOPe 2.07
  
• d2wdqj2 appears in the current release, SCOPe 2.08