SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2wdqj1 (2wdq J:1-106)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2159798Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2159971Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 protein domains)
  6. 2160072Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species)
  7. 2160083Species Escherichia coli [TaxId:562] [82587] (5 PDB entries)
  8. 2160086Domain d2wdqj1: 2wdq J:1-106 [198488]
    Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqa3, d2wdqb2, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe2, d2wdqe3, d2wdqf2, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi2, d2wdqi3, d2wdqj2, d2wdqk_, d2wdql_
    automated match to d1nekb2
    complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo

Details for d2wdqj1

PDB Entry: 2wdq (more details), 2.4 Å

PDB Description: e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound
PDB Compounds: (J:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d2wdqj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wdqj1 d.15.4.2 (J:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc
gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd

SCOPe Domain Coordinates for d2wdqj1:

Click to download the PDB-style file with coordinates for d2wdqj1.
(The format of our PDB-style files is described here.)

Timeline for d2wdqj1: