| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) ![]() |
| Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins) |
| Protein Succinate dehydogenase [81708] (2 species) |
| Species Escherichia coli [TaxId:562] [81709] (6 PDB entries) |
| Domain d2wdqi3: 2wdq I:451-588 [198487] Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqb1, d2wdqb2, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe2, d2wdqf1, d2wdqf2, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi2, d2wdqj1, d2wdqj2, d2wdqk_, d2wdql_ automated match to d1neka1 complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo |
PDB Entry: 2wdq (more details), 2.4 Å
SCOPe Domain Sequences for d2wdqi3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wdqi3 a.7.3.1 (I:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr
vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs
vnmepklrpafppkirty
Timeline for d2wdqi3: