SCOPe 2.03: Domain d2wdqi2: 2wdq I:236-355

Lineage for d2wdqi2 (2wdq I:236-355)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
   unusual fold

4. Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family)

5. Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)

6. Protein Succinate dehydogenase [82818] (1 species)

7. Species Escherichia coli [TaxId:562] [82819] (6 PDB entries)

8. Domain d2wdqi2: 2wdq I:236-355 [198486]
   Other proteins in same PDB: d2wdqa1, d2wdqa3, d2wdqb1, d2wdqb2, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe3, d2wdqf1, d2wdqf2, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi3, d2wdqj1, d2wdqj2, d2wdqk_, d2wdql_
   automated match to d1neka3
   complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo

Details for d2wdqi2

PDB Entry: 2wdq, 2.4 Å

PDB Description: e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound

PDB Compounds: (I:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wdqi2:

Sequence; same for both SEQRES and ATOM records:

>d2wdqi2 d.168.1.1 (I:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
memwqfhptgiagagvlvtegcrgeggyllnkhgerfmeryapnakdlagrdvvarsimi
eiregrgcdgpwgphaklkldhlgkevlesrlpgilelsrtfahvdpvkepipviptchy

Timeline for d2wdqi2:

• d2wdqi2 is new in SCOPe 2.03-stable
  
• d2wdqi2 appears in SCOPe 2.04
  
• d2wdqi2 appears in the current release, SCOPe 2.08