Lineage for d2wdqi2 (2wdq I:236-355)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442462Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 1442463Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 1442464Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 1442533Protein Succinate dehydogenase [82818] (1 species)
  7. 1442534Species Escherichia coli [TaxId:562] [82819] (6 PDB entries)
  8. 1442537Domain d2wdqi2: 2wdq I:236-355 [198486]
    Other proteins in same PDB: d2wdqa1, d2wdqa3, d2wdqb1, d2wdqb2, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe3, d2wdqf1, d2wdqf2, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi3, d2wdqj1, d2wdqj2, d2wdqk_, d2wdql_
    automated match to d1neka3
    complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo

Details for d2wdqi2

PDB Entry: 2wdq (more details), 2.4 Å

PDB Description: e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound
PDB Compounds: (I:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wdqi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wdqi2 d.168.1.1 (I:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
memwqfhptgiagagvlvtegcrgeggyllnkhgerfmeryapnakdlagrdvvarsimi
eiregrgcdgpwgphaklkldhlgkevlesrlpgilelsrtfahvdpvkepipviptchy

SCOPe Domain Coordinates for d2wdqi2:

Click to download the PDB-style file with coordinates for d2wdqi2.
(The format of our PDB-style files is described here.)

Timeline for d2wdqi2: