Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Protein Succinate dehydogenase [81669] (3 species) |
Species Escherichia coli [TaxId:562] [81670] (6 PDB entries) |
Domain d2wdqf2: 2wdq F:107-238 [198483] Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqa3, d2wdqb1, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe2, d2wdqe3, d2wdqf1, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi2, d2wdqi3, d2wdqj1, d2wdqk_, d2wdql_ automated match to d1nekb1 complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo |
PDB Entry: 2wdq (more details), 2.4 Å
SCOPe Domain Sequences for d2wdqf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wdqf2 a.1.2.1 (F:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai ghiksmllqrna
Timeline for d2wdqf2: