SCOPe 2.03: Domain d2wdqd_: 2wdq D:

Lineage for d2wdqd_ (2wdq D:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (4 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein Succinate dehydrogenase subunit SdhD [82872] (1 species)
   membrane anchor protein

7. Species Escherichia coli [TaxId:562] [82873] (6 PDB entries)

8. Domain d2wdqd_: 2wdq D: [198478]
   Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqa3, d2wdqb1, d2wdqb2, d2wdqc_, d2wdqe1, d2wdqe2, d2wdqe3, d2wdqf1, d2wdqf2, d2wdqg_, d2wdqi1, d2wdqi2, d2wdqi3, d2wdqj1, d2wdqj2, d2wdqk_
   automated match to d1nekd_
   complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo

Details for d2wdqd_

PDB Entry: 2wdq, 2.4 Å

PDB Description: e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound

PDB Compounds: (D:) succinate dehydrogenase hydrophobic membrane anchor subunit

SCOPe Domain Sequences for d2wdqd_:

Sequence; same for both SEQRES and ATOM records:

>d2wdqd_ f.21.2.2 (D:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]}
ngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftllalfsili
hawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv

Timeline for d2wdqd_:

• d2wdqd_ is new in SCOPe 2.03-stable
  
• d2wdqd_ appears in SCOPe 2.04
  
• d2wdqd_ appears in the current release, SCOPe 2.08