Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (4 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein Succinate dehydrogenase subunit SdhD [82872] (1 species) membrane anchor protein |
Species Escherichia coli [TaxId:562] [82873] (6 PDB entries) |
Domain d2wdqd_: 2wdq D: [198478] Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqa3, d2wdqb1, d2wdqb2, d2wdqc_, d2wdqe1, d2wdqe2, d2wdqe3, d2wdqf1, d2wdqf2, d2wdqg_, d2wdqi1, d2wdqi2, d2wdqi3, d2wdqj1, d2wdqj2, d2wdqk_ automated match to d1nekd_ complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo |
PDB Entry: 2wdq (more details), 2.4 Å
SCOPe Domain Sequences for d2wdqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wdqd_ f.21.2.2 (D:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]} ngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftllalfsili hawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv
Timeline for d2wdqd_: